SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010473 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010473
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.65e-80
Family Proteasome subunits 0.00000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010473   Gene: ENSTTRG00000011050   Transcript: ENSTTRT00000011048
Sequence length 248
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1906:15066:20612:-1 gene:ENSTTRG00000011050 transcript:ENSTTRT00000011048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
Download sequence
Identical sequences Q3ZBG0
ENSTTRP00000010473 ENSBTAP00000006760 ENSTTRP00000010473 9913.ENSBTAP00000006760 NP_001029405.1.59421 NP_001029405.1.76553 XP_004282376.1.21590 XP_004313313.1.83887 XP_006072351.1.26621 XP_006744680.1.47382 XP_006744681.1.47382 XP_007462327.1.90284 XP_008155317.1.99482 XP_008155318.1.99482 XP_010986149.1.51371 XP_011964384.1.54773 XP_017913084.1.57651 XP_019281917.1.44245 XP_019492671.1.44202 XP_019827659.1.53367 XP_020756786.1.74333 ENSBTAP00000006760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]