SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010498 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010498
Domain Number 1 Region: 627-813
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-54
Family DBL homology domain (DH-domain) 0.00000000761
Further Details:      
 
Domain Number 2 Region: 818-958
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-38
Family Pleckstrin-homology domain (PH domain) 0.000000148
Further Details:      
 
Domain Number 3 Region: 317-399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000521
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 4 Region: 1067-1112
Classification Level Classification E-value
Superfamily SH3-domain 0.00000269
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 5 Region: 142-229
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000549
Family CRAL/TRIO domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010498
Domain Number - Region: 465-555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0623
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010498   Gene: ENSTTRG00000011066   Transcript: ENSTTRT00000011073
Sequence length 1133
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1165:244739:358794:1 gene:ENSTTRG00000011066 transcript:ENSTTRT00000011073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGCWRFVLCKETGGDSGPPARGPSEAKEEESDPRVDVSDVIRLVQNQPGGTPTPADEIM
HHDISPLCAADIQDQLQKRFAYLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLQDAGIGFILVIDRRQDKWTSVKASILRIAASFPANLQLVLVLRPTGFFQRTLSDLA
FRFNRDDFKMVPVIMLSSVPELHSYIDKSQLTEDLGGTLDYCHSRWLCHRTAIESFALLV
KQTAQMLQAFGTELAETELPNDVQSTSSVLRXXXXXXXXXXXEDMRLALDEGRSVLESIR
EPLARGPEQSPNQDQLDSQSTVQRLLAQLSETEAAFDEFWAKHQRKLEQCLQLRHFEQDF
REVKAALDVLAQKITTFTDVGNSLAHVQHLLKDLASFEEKSSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLCGQFAADVGRRRGLLGRALDLHGLLEASMKWCDEGIYLLAS
QPVDKCQAQDGAEAALQEVEKFLETRAENKIQELSKIYQDYEPILTRDLLEHVQKVFRKQ
ESVEEMFHRRQASLKKLAAKQTRPVQPVAPRPEAPAKSPCPSPGIRRGSEIHSSEGSVLR
RGPYRRARSEVSEGRQGRGRSTGDEESLAVLRRHVMNELLDTERVYVEELLCILEGYAAE
MDNPLMTHLISTGLQNKKDVLFGNMEEIYHFHNRIFLRELENYIDCPELVGRCFLERMEQ
FQVYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKE
MLKYSKSCEGAEDLQEALSSILGILKAVNDSMHLIAITGYEGNLSDLGKLLMQGSFSVWT
DHKKGHTKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSFKQSLNMTAVG
ITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVSEIRKVLTSQLQACREASQHRAL
EQSHSLPLPAPAGTSPSKGNTKDVRKLEERKTDPLTLEGYVGPAPLPRPPEKGRGWSKTS
NPPEAPEDNDGWSSAEEPVNSSDAEEEGRAGLRKLVPGKYTVTGLDEKGGPDALVLRSGD
EVELVQEGDEGLWFVRNVSSGGEGWLPARNLSALLGQRGAPGCLSSPGTGREA
Download sequence
Identical sequences ENSTTRP00000010498 ENSTTRP00000010498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]