SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010518 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010518
Domain Number 1 Region: 464-768
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.44e-102
Family PDEase 0.00000059
Further Details:      
 
Domain Number 2 Region: 250-441
Classification Level Classification E-value
Superfamily GAF domain-like 1.37e-47
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 93-241
Classification Level Classification E-value
Superfamily GAF domain-like 1.9e-19
Family GAF domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010518   Gene: ENSTTRG00000011086   Transcript: ENSTTRT00000011093
Sequence length 783
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_836:16480:314691:-1 gene:ENSTTRG00000011086 transcript:ENSTTRT00000011093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKPEDE
SSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFL
GECNNSLCVFTPPGIKEGKPRLIPAGPIAQGTTTSAYVAKSRKTLLVEDILGDERFPRGT
GLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQV
QVCTGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKSK
ELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVD
LYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANM
YHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMHFNLPARLCKEIELFHFDIGPFENMWP
GIFVYMVHQSCGTACFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHGL
FTELERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEG
HNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIG
LMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQL
GFYNAVAIPCYATLTQILPPTEPLLKACRNNLSQWEKVIRGEESAVWISNPPAAQGTAAR
EDR
Download sequence
Identical sequences ENSTTRP00000010518 ENSTTRP00000010518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]