SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010544 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010544
Domain Number 1 Region: 1902-2098
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-54
Family DBL homology domain (DH-domain) 0.0000125
Further Details:      
 
Domain Number 2 Region: 1240-1416
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-50
Family DBL homology domain (DH-domain) 0.00000000882
Further Details:      
 
Domain Number 3 Region: 2737-2996
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-41
Family Protein kinases, catalytic subunit 0.000012
Further Details:      
 
Domain Number 4 Region: 2100-2222
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.00066
Further Details:      
 
Domain Number 5 Region: 1420-1538
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2628-2724
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 256-392
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-20
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1052-1189
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-20
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 477-618
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 10 Region: 858-959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000089
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 11 Region: 2493-2557
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000938
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1588-1679
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000381
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 13 Region: 12-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 170-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010544
Domain Number - Region: 623-686
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000183
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number - Region: 397-509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010544   Gene: ENSTTRG00000011119   Transcript: ENSTTRT00000011119
Sequence length 3046
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_109:761444:1000346:1 gene:ENSTTRG00000011119 transcript:ENSTTRT00000011119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLAC
IPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFG
SSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSR
LEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSDSFP
KKNSGSGNADLQSLLPKVSAMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMF
DWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVASRLVESGH
YASQQIKQIASQLEQEWKAFAAALDERSTLLDMSSVFHQKAEKYMSNVDSWCKACGEVDL
PSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKA
VHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKH
TGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLE
DRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRF
GQQQQTTLQVTVNVIKEGEDLIQQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHAD
KALTMNNLTFDVIHQGQDLLQYVNEVQASVVGLLGRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVQLRHLQEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQ
HAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASV
AFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKAC
TLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRL
DQCQQYVVFERSAKQALEWIHDSGEFYLSTHTSTGSSIQHTQELLKEHEDFQITAKQTKE
RVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNK
SSKSLQLDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIMAELIQTEKAYVRDLREC
MDTYLWEMTSGVEEIPPGIVNKELVIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFV
TWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQL
LLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQV
WDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCK
FALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPAT
RQGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSTEL
TIRRGQTVEVLERPHDKPDWCLVRTTDRSPAVEGLVPCGSLCIAHSRSSMEMEGIFNHKD
SLSVSSNDASPPASVASLQPHMMGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKK
LAHKHKKSREVRKSADAGSQKDSDDSAATPQDETVEEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASSRLLVRPTSSETPSAAELVSAIEE
LVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQ
ELVETERDYVRDLGCVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELE
KCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTD
LLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPKRCNDMMNVGRLQGFD
GKIVAQGKLLLQDTFLVTDQDTGLLPRCKERRVFLFEQIVIFSEPLDKKKGFSVPGFLFK
NSIKVSCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQAWIHEINQILENQRN
FLNALTSPIEYQRNHSGGGGGGSGGGGGGAPSGVGGSSGAGSNHSGGPGSCGGLPSASRS
RPSRIPQPVRHHSPVLVSSAASNQAEADKMSGMSTPGPSLPPPSSSPAPEAGQPARAPPS
GEPEGPEREAEPIPKMKVLESPRKAAGNAAGAHQDGPAKEARSGPGSLPPGKPRPGAISP
LNSPLSAAFPSPFGKEPLPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDSDSLQRQAQR
HAAPSKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQG
EVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIMENPDGTLKKSTSWHTA
LRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVT
CETGETVVLRCRVCGRPKASVTWKGPEHNTLNSDGHYSISYSDLGEAALKIVGVTTEDDG
IYTCIAVNDMGSASSSASLRVLGPGSDGVMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQ
KGTKRAVATKFVNKKLMKRDQVTHELGILQNLQHPLLVGLLDTFETSTSYVLVLEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENILVDQSLAKPTIKLA
DFGDAVQLNTTYHIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLAYVLLSGVSPFLDD
SVEETCLNICRLDFSFPDDYFQGVSQRAKDFVCFLLHEDPAKRPSAALALQEQWLQSGHG
HGHGKGAGVLDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences ENSTTRP00000010544 ENSTTRP00000010544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]