SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010558 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010558
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010558   Gene: ENSTTRG00000011137   Transcript: ENSTTRT00000011135
Sequence length 464
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1:125935:147763:1 gene:ENSTTRG00000011137 transcript:ENSTTRT00000011135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQLTRRGALSLLLFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGKHVIR
YTAYDQAYNRASCKFIVKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXMKINVNVNSAAGLLDQFYEKRRLLIISAPDPSNRYYKMQI
SMLQXXXXCGLDLRHVTIIELVGQPPQEVGRIREQQLSASIIEELRQFQHLTRSYFNMVL
IDKHGIDRERYMEPVTPEIFTFIDDYLLSNQELTQRQMQRDICE
Download sequence
Identical sequences ENSTTRP00000010558 ENSTTRP00000010558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]