SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010669 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010669
Domain Number 1 Region: 74-571
Classification Level Classification E-value
Superfamily Clc chloride channel 4.05e-96
Family Clc chloride channel 0.00052
Further Details:      
 
Domain Number 2 Region: 573-650,763-843
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-27
Family CBS-domain pair 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010669   Gene: ENSTTRG00000011253   Transcript: ENSTTRT00000011253
Sequence length 901
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3548:109242:123547:-1 gene:ENSTTRG00000011253 transcript:ENSTTRT00000011253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWRGPPSPR
AAPELLEYGQSRCTRCRICTVHCHKFLVSRVGEDWIFLVLLGLLMALVSWAMDYAIAACL
QAQQWMSRGLNTNLLLQYLAWVTYPVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVL
KEYLTLKTFVAKVIGLTCALGSGMPLGKEGPFVHIASMCAALLSKFLSLFGGIYENESRN
TEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFIFRVLAVWN
RDEETITALFKTRFRLDFPFDLQELPAFAVIGIAXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLMEELE
PPGTSQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIGAAFGRLVGES
MAAWFPDGIHTDGSTYRIVPGGYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMI
AVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCT
FRDLRLALHRTKGRVLALVESPESMILLGSIECSQVVALLGAQLSPARRRQYMQEHRAAR
TSSPSDQESPPSPETSLLFQVNTEDSGFPAARGETHKPLKPALKRGPSNTMNLKESPTGN
MEQAGIALRSLFCGSPPPEPASEKSEKCDKRKPKRVRISLASDSDLEGEMPEEILEWEEQ
QLDEPVNFSDCKIDPAPFQLVERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRK
AIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPRSRHGLPREGSPSDSDDKC
Q
Download sequence
Identical sequences ENSTTRP00000010669 ENSTTRP00000010669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]