SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010691 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010691
Domain Number 1 Region: 112-379
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-70
Family Protein kinases, catalytic subunit 0.000036
Further Details:      
 
Domain Number 2 Region: 50-129
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-20
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010691
Domain Number - Region: 418-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00365
Family Regulator of G-protein signaling, RGS 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010691   Gene: ENSTTRG00000011275   Transcript: ENSTTRT00000011276
Sequence length 1111
Comment pep:known_by_projection scaffold:turTru1:scaffold_98649:23007:93813:-1 gene:ENSTTRG00000011275 transcript:ENSTTRT00000011276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRALSGCLANAAAAAPPGEDGGARAEEEEEEEEEAAAAVPRELGSDAPLYWTAVFEYE
AAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPR
GEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQT
IENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVN
WAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSKKVLKITDFGLAREWHRT
TKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMN
KLALPIPSTCPEPFAKLMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFHCLQD
DWKHEIQEMFDQLRAKEKELHTWEEELTRAALQQKNQEELLRRRERELAEREIDILQREL
HIIIHQLCQEKPRVKKRKGKFRKNRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLIN
SRSSPPASPTIIPRLRAIQLTPGESSKTWGRSCVVPKEEGEEEEKRAPKKKGRTWGPGTL
GQKEFASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLGKGPRNSP
ALPGFTSLMEMAVAPLWLVDSLEDEDSEGPRSGESRPQPSPNQSYLCIPFPRGEDGDGPP
GDGVHEEPTPVNSATSTPQLTPTNSLKRGGPHHRRCEVALLGCGAVLAATGLGCDLLEAG
KCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSPPSRKLFKKEEPVLLLGDPSASLT
LLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPGEAPPLSPCTRNPLVNVRVERFKRDPR
QSLTPTHVTLTAPPQPSAHRRTPSDGALKPAAPRASRSPSSNGLSPSPGAGMLKTPSPSR
DPGEFPRLPDPNVVFPPTPRRWNTQQDSALERPKTLEFLPRPRPSANRQRLDPWWFVSPS
HARSASPANSSSTETPSNLDSCLASSSSTVEERPGLPALPPFQAGPLPPAERTLLDLDAE
GQSQDGTVPLCRAALNTHRPAPYEIQQEFWS
Download sequence
Identical sequences ENSTTRP00000010691 ENSTTRP00000010691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]