SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010733 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010733
Domain Number 1 Region: 317-507
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-53
Family cAMP-binding domain 0.00000000567
Further Details:      
 
Domain Number 2 Region: 52-201,254-320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.11e-27
Family Voltage-gated potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010733   Gene: ENSTTRG00000011320   Transcript: ENSTTRT00000011320
Sequence length 742
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2724:14591:35663:1 gene:ENSTTRG00000011320 transcript:ENSTTRT00000011320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGESRGSQTFMQRQLGALLQPVNKFSLRFGSQKTVEREQERVKSAGAWIIHPDSDFRFY
WDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNT
EIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKILS
LLRLLRLSRLIRYIHQWEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGAT
CYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMF
DEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIR
EGTVGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSL
SVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQE
IVKYDREMVQQAELGQRVGLFPPPPPPPPQGASAIATLQQAVAMSFCPVAHPLVGLALGS
PRLVHRLPPGPAPTAASPGPGPAASPPGAPSSPRAPRTSPYGGVPGSHAAPCAGPALPAR
RLSRASRPLSASQPSLPHGAPGPGPGPGASVRPASSSTPRLGPAPAARAAGPSPKRRDSA
SPSPSPGANGGPDPLDSARSRL
Download sequence
Identical sequences ENSTTRP00000010733 ENSTTRP00000010733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]