SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010735 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000010735
Domain Number - Region: 70-198
Classification Level Classification E-value
Superfamily PH domain-like 0.000622
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010735   Gene: ENSTTRG00000011326   Transcript: ENSTTRT00000011322
Sequence length 909
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1410:26911:179108:-1 gene:ENSTTRG00000011326 transcript:ENSTTRT00000011322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNYVRSEVEQQRDLTSQFLK
TKPPLEPGTVLYEAELSQFAEDIKKWKERYVVVKNDFAVESYENKEAYQRGAPPKSRILP
AGGKVLTSEDEYGLLSDRHFPDPIASSEKENTQPFVVLPKEFPVYLWQPFLRHGYFCFQN
AADQRKFSALLSDCIRHLNHDYMKQTTFEVQAFLEAVQFFRQEKGHYGSWEMITGDEVQI
LSNLVMEELMPTLQTDILPKMKGKKNDRKRAWFGLLEEAYNLVRHQVSEGLSALKEECRA
LTKGLEGTIRSDMDQIVNSKNFLIGKIKAMVAQPAERSCAESVQPFLASILEELMGPVSS
GFSEVRSLFEKEVDELNQNFQSTKDSAQLKEHLDRLMNLPLDSVKMEPCYSKVNLLQEHL
QDLKSRFRFPHIDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGEASKTTVAIEKVKLRV
LKQYDYDSSTIRKRIFQEALVQITLPTVQKALASVCKPELQKYEQFIFADHTNMIHVENV
YEEILHQILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKTPAGSNQASPARR
ASAILPEVPDSEILSNEVFQESGEKKQPGVPMPSPPPDGDGQVIISSTDDPVVNPVAAED
TAGALGKHSSELEFGETHEGQEPTQEKPEPTSALGSLKELRNLLMVTTEVPGESAAPEIE
KDTSKETLVPQEIEKEEETTQIYTETDQAAASSQVNSEESEVSEREVHPPSPEAEACGVE
LGASPEAQPACGGLSEGPLEPTERELTAGSSGLDALEGGGPRCAVEAEAMPQEGCKLSCD
PVSPGESQVSLQEEAVGGSHSTAQATASVEAKKSKATRVHECQWVVESDADTYSLDSQRE
DPPERPSEE
Download sequence
Identical sequences ENSTTRP00000010735 ENSTTRP00000010735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]