SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010830 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010830
Domain Number 1 Region: 117-254
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.5e-34
Family Proteasome subunits 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010830   Gene: ENSTTRG00000011421   Transcript: ENSTTRT00000011421
Sequence length 259
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2174:30736:33810:1 gene:ENSTTRG00000011421 transcript:ENSTTRT00000011421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALLESRCGPAPGQFYRIPPTPGSSVDPASALYGGPITRTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEELLGDG
HSYSPKAIHSWLTRATYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSVATG
YGAYLAQPLLREVLEKKPVLSQTEAQELVERCMRVLYYRDARSYNRFQIATVTEKGVEIE
GPLSAETSWDIAHMISGFE
Download sequence
Identical sequences ENSTTRP00000010830 ENSTTRP00000010830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]