SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010890 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010890
Domain Number 1 Region: 42-367,416-564
Classification Level Classification E-value
Superfamily Clc chloride channel 4.84e-104
Family Clc chloride channel 0.00024
Further Details:      
 
Domain Number 2 Region: 564-613,713-816
Classification Level Classification E-value
Superfamily CBS-domain pair 4.72e-21
Family CBS-domain pair 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010890   Gene: ENSTTRG00000011473   Transcript: ENSTTRT00000011482
Sequence length 922
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2899:32831:55574:1 gene:ENSTTRG00000011473 transcript:ENSTTRT00000011482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTILGETQEEEDEILPRKDYESLDYDRCINDPYLEVLETMDNKKGRRYEAVKWMMVFAIG
VCTGLVGLFVDFFVRLFTQLKFGVVQASVEECSQKGCLALSLLELLGFNLTFVFFASLLV
LIEPVAAGSGIPEIKCYLNGVKVPGIVRLRTLLCKVFGVLFSVAGGLFVGKEGPMIHSGA
VVGAGLPQFQSLSLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFSLEEG
SSFWNQGLTWKVLFCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFGEFKCSDSDKKCHL
WTAMDLGFFVVMGVVGGLLGATFNCLNKRLAKYRMRNVHPKPKLVRVLESLLVSLVTTVV
VFVASMVLGECRQMSSASQVGNDSFALQVTSDEVNSSIKTFFCPNETYNDMATLFFNSQE
SGILQLFHQDSTFSPITLALFFVLYFVLACWTYGISVPSGLFVPSLLCGAAFGRLVANVL
KSYIGLGHIYSGTFALIGAAAFLGGVVRMSISLTVILIESTSEITYGLPIMVTLMVAKWT
GDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRT
TVHHAFPVVTENRGNEKEFMKGNQLISNNIKYKKCSILTRAGEQRRRSQSMKSYPSSELR
NVCDEHVTSEDPGEKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILR
SQLVTLLVRGVCYSESQSSASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYM
NPAPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEVSEGTALAASSGRDPLGCCRGGGA
SHQEQQNPAGRGVRGPAVASNLPLCLRDAVSCVPADVASVSLVFPLRPRSAGPCLPETFL
FTLDCSLRRGSVPPLYGNLCSK
Download sequence
Identical sequences ENSTTRP00000010890 ENSTTRP00000010890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]