SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010911 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010911
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000379
Family AN1-like Zinc finger 0.0014
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000445
Family AN1-like Zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010911   Gene: ENSTTRG00000011506   Transcript: ENSTTRT00000011506
Sequence length 158
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2400:311934:316833:-1 gene:ENSTTRG00000011506 transcript:ENSTTRT00000011506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPLECDACKQDFCKDHFTCAAHKCPFAFKKDVQVPVCPLCNSPIPVKTGEVPDVVVGEH
MDGACKHHPGKKKEKLFTYRCSKEGCRRKEMLRVTCAECRGSFCIQHRHPQDHGCTRGRP
AASTAGCSAARDSEPGPSGASRDRGWLARRFRYWRGRA
Download sequence
Identical sequences ENSTTRP00000010911 ENSTTRP00000010911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]