SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010926 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010926
Domain Number 1 Region: 30-415
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-66
Family L-arabinose binding protein-like 0.00038
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010926
Domain Number - Region: 418-463
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0134
Family TNF receptor-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010926   Gene: ENSTTRG00000011521   Transcript: ENSTTRT00000011521
Sequence length 761
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2942:34954:54311:-1 gene:ENSTTRG00000011521 transcript:ENSTTRT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRAGVCSLSFLLIFLAELTENSEFSLLEDYLLGGLFTLHANVKGTVHLNYLQVPKCNE
YEMKVLGYNLMQAMRFAAEEINNDSSLLPSVLLGYEMVDTCYMSNNIHPVLYFLSQDDYF
LPIQEDYSHYIPRVVAITGPDTSECPVTVAHFLSLFLLPQITYGTINDQLHFPAVLRTAP
GVHHQMEAMVPLMRHFRWNWILVLTSSDDYGRGSSQLLSECLAHRDICIAFRETLPRPQP
DRTMTQQERERLEAIMGKLQQSMARVVAVSSPDLALFNFFREVLRQNSTGAVWVASEPWA
IEPVLHHLTQLQRTGTFLGFTTQSVPIPGFSEFRVHRSQVSRPALNRSSPGATCNQECDT
CMDTSESFNTILTLSGERVVYSVYSAVYAVAHALQSLLGCNQTGCHKEVVYPWQIAVSMC
SKDCHPGQKKKPAGIDPGCFKYIDCLSGTFLNRAAGEFDCQPCPSYEWSRRKDTSCFKRQ
LAFLEWHEAPTITVVVLAALGFLGTLAVSIIFWRQFQTPMVRSAGGPVCFLMLTPQLMAY
MVVPVYVGPPMVSTCLCLQAFLTLCFTVCISCITVRSFQIIIFKMARRLPRAYGFWVRYH
GLCVFVAFITVLKTVIVGSSILAVTTNSTARTDPDDPKVTTLSCNPSYHRGLRINSSLLL
VSVLGFGFAHIGKELPTNYYEAKFITCMTFYFTSSVFLCTFVSVYEGVLVTTLGLLVTVL
YLLGITLGYFGPKCYMILFYLERHTPAYVNSMIQGYTMGRG
Download sequence
Identical sequences ENSTTRP00000010926 ENSTTRP00000010926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]