SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011014 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011014
Domain Number 1 Region: 60-276
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3e-66
Family DNA/RNA non-specific endonuclease 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011014   Gene: ENSTTRG00000011615   Transcript: ENSTTRT00000011614
Sequence length 291
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2508:304028:307843:1 gene:ENSTTRG00000011615 transcript:ENSTTRT00000011614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQLLRGGLTLALGALGAAAEGWRRLAAPGLLSRLPVLPVAAAAGLPPWPGAXXXSPSEVG
KYGLPGGAQLKSRESYMLCYDPRTRCALWVVEQLRPENLRGDGDRRCDFHEDDSVHAYHR
ATNADYGGSGFDRDHLAAAGNHRWSQKAMYDTFYLSNIAPQVPHLNQNAWNNLERYSRSL
TRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAADGQIELRS
YVMPNAPVDEAVPLERFLVPIESIERASGLLFVPNILARTGSLKAITAGSK
Download sequence
Identical sequences ENSTTRP00000011014 ENSTTRP00000011014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]