SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011036 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011036
Domain Number 1 Region: 241-373
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-45
Family Regulator of G-protein signaling, RGS 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011036   Gene: ENSTTRG00000011639   Transcript: ENSTTRT00000011637
Sequence length 380
Comment pep:known_by_projection scaffold:turTru1:scaffold_112963:74369:151626:1 gene:ENSTTRG00000011639 transcript:ENSTTRT00000011637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLSPDNQEELQKHFSRPSMPIQFLLPPRAEEYNANIHQTVENEGGTIARHNVKPCPPA
QLPGSPAAPKLLGFLSGTLSGLARFFAHLLQRPLPGAPLRRPDFSLLLPVLPAAGLAPRQ
EERPGRLSLLLRAALALPGRPPGGRLPREEDAGAGQSPPRPPMGSERVEMRKRQVCAAQG
PAAAAPGPRGVGNRGPNACCFCWCCCCSCSCLTVRNQEEQRLRSASYELRTEDLPICEES
PGPSLEEASAWAQSFDKLMLTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKTTIE
EKARIIYEDYVSILSPKEVSLDSRVRETINRSMAEPSPHIFDDAQLQIYTLMHRDSYPRF
MNSALYKDLLRSLSEKAVEA
Download sequence
Identical sequences ENSTTRP00000011036 ENSTTRP00000011036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]