SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011053 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011053
Domain Number 1 Region: 458-654,755-1011
Classification Level Classification E-value
Superfamily Ras GEF 1.14e-115
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 201-339
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-43
Family DEP domain 0.00000018
Further Details:      
 
Domain Number 3 Region: 662-764
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.54e-36
Family Ras-binding domain, RBD 0.00099
Further Details:      
 
Domain Number 4 Region: 332-461
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-25
Family cAMP-binding domain 0.000000889
Further Details:      
 
Domain Number 5 Region: 21-158
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-20
Family cAMP-binding domain 0.000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011053   Gene: ENSTTRG00000011651   Transcript: ENSTTRT00000011655
Sequence length 1012
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_442:363542:683495:1 gene:ENSTTRG00000011651 transcript:ENSTTRT00000011655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNTYLHQICLCG
YYENXXXXXXXFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILD
NTPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKEN
TPLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGT
ELVDWMLQQTPCVHSRIQAVGMWQVLVEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPL
PTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSH
LSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGD
DFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEK
VPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPALNEATDSVLNDFVMMHCV
FMPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDVLQEDDVAM
AFLEEFYVSVSDDAWMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDDRAQ
KRQPIRGSDEVLFKVYCMDHTYTTIRVPVAASVKEVLSAVADKLGSGEGLIIIKMSSGGE
KVVLKPNDVSVFTTLTINGRLFACPREKFDSLTPLPEQEGPTVGTMGTFELMSSKDLAYQ
MTVYDWDLFSCVHELELIYHTFGRHHFKKTTANLDLFLRRFNEIQFWVVTEICLCSQPSK
RVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESL
MDPSRNHRAYRLTVAKLDPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTAR
TVRYCRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences ENSTTRP00000011053 ENSTTRP00000011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]