SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011097 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011097
Domain Number 1 Region: 997-1127
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-39
Family Pleckstrin-homology domain (PH domain) 0.00000133
Further Details:      
 
Domain Number 2 Region: 767-949
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-38
Family DBL homology domain (DH-domain) 0.000000202
Further Details:      
 
Domain Number 3 Region: 435-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.47e-34
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 4 Region: 69-148
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-18
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011097   Gene: ENSTTRG00000011693   Transcript: ENSTTRT00000011700
Sequence length 1542
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1499:242912:383287:1 gene:ENSTTRG00000011693 transcript:ENSTTRT00000011700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEXXXXXRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQFPLADSEVEPSVVGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYSRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAAVTSSKPLGDGLAVSEIEADPGDGLGRIDYGSGDAS
RPSSESADSPKSGLKERIYLEENPEKSEVIQDTDTQSLIGSPSTRIAPHIIGAEDDDFGT
EHEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXHLKVSVPDEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKIDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGRAMELQKQRHPKHISTPSSVSPEPQDSAKLRQSGLTSEGVDTGY
LPANSMSSMVSGATLSQEGGKENDMGSKQVGETPASGDSLDGTPRTPSTIFDFPPPPLDQ
VQEEEWEVERVTEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLA
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSGPGEEKLHAAATFCSNQPFALQMIKSR
QKDSRFQTFVDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKMIHE
GPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTGDSKHTFSPVIKLN
TVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIP
LPQSPPCEGDNDEEEPPKLKVEHHGISVSGLQSPDRDLGLESPLMSSKPQSHSLDTSGKS
EVDDDLFVADRQFAKEQHADGTLKEVGVNYQITVPDPHLPVSEERWALDALRNLGLLKQL
LVQQLGLTEKSTQEDWPHFPRCRTASLGAQADSGTQKPGNIKAYHPCEGQMPFRTGTGDI
STCYSPRTSTESSAPRDSVVLAFQDSQASNILVMDHMIMTPEMPPAEPEGGLDESGEHFF
DAREAHSDDNPSEGDGAVKKEEKDVNLRISGTCLILDGYETVQESSTDEEIASSLPPQPA
TGIPSMDSTRRQQRSPQNAHSDGAVSPFTPEFLVQQRWGAMEDSCLEIRSPSSCADSQSQ
IMECIRKIEADLEHLKKVEESYSILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences ENSTTRP00000011097 ENSTTRP00000011097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]