SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011122 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011122
Domain Number 1 Region: 10-180,282-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-48
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011122   Gene: ENSTTRG00000011726   Transcript: ENSTTRT00000011725
Sequence length 486
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_443:78441:132777:1 gene:ENSTTRG00000011726 transcript:ENSTTRT00000011725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSDIQRKNIAVIGGGLVGSLNACFLAKRNFQVNVYEAREDIRVTKFARGRSINLALSY
RGRQALKSIGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSISRENLNKDLLT
AVEKYPNAKVHFGHRLLKCNPEEGTITVLGHENVAKDVTCDLIVGCDGAYSTVRTHLMKK
PRFDYSQQYIPHGFMELTIPPKNGDYAMEPNYLHIWPRDTFMMIALPNMNKSFTCTLFMP
FEEFEKLQTSSDVLNFFQKYFPDSIPLIGKQTLAQDFFLLPAQPMISVKCSSFHFKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSMCLPEFSRLRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQKNIERFLHAIMPSTFIPLYTMVTFSRIRYHEAVLRWHWQKK
VINKGLFFFGTLIAVSGTYLLMRSKSLRPLDYLRRPWDWVTYFQNTACLPVNSLESLEQI
PNVIRK
Download sequence
Identical sequences ENSTTRP00000011122 ENSTTRP00000011122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]