SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011133 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011133
Domain Number 1 Region: 179-324
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-31
Family AlaX-like 0.018
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000001
Family Co-chaperone p23-like 0.00085
Further Details:      
 
Domain Number 3 Region: 120-177
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000006
Family AlaX-M N-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011133   Gene: ENSTTRG00000011737   Transcript: ENSTTRT00000011737
Sequence length 493
Comment pep:novel genescaffold:turTru1:GeneScaffold_106:256211:274891:-1 gene:ENSTTRG00000011737 transcript:ENSTTRT00000011737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YNEIEFYAKVNCKDSRDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDW
EGDEEVELAQVDHYAELLEKVRTKRPPPAMDDLDFTTTVVSCSPAELQTEGSNGKKEVLS
GFRVVLEDTLLFPEGGGQPDDRGTINDISVLRVTRRGAQADHFTQTPLTPGTEVQVRVDW
ERRFDHMQQHSGQHLITAVADHLFGLKTTSWELGRLRSVIELDSPSVTAEQVAAIEQSVN
EKIRERLPVYVRELSLDDPGVEQVRGRGLPDDHAGPIRVVTIKSVDSNMCCGTHVSNLSD
LQVIKILGSEKGKKNKTNVTFLAGNRVLKWMEKSHSTEKALTALLKCGAEDHVEAVKKLQ
NSNKLLQKSNLNLLRDLAVHVAHSLRNSPDWGGVVTLHRKEGDSEFMNIIANEIGSEETL
LFLTVGEEKGAGLFLLAGPAEAVETLAPRVAEVLEGKGAGKKGRFQGKATKMSRRAEVQA
LLQDYVSTQSAEE
Download sequence
Identical sequences ENSTTRP00000011133 ENSTTRP00000011133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]