SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011152 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011152
Domain Number 1 Region: 217-315
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.08e-47
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.00000459
Further Details:      
 
Domain Number 2 Region: 73-164
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.24e-33
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.0000122
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.32e-22
Family CAD domain 0.0000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011152   Gene: ENSTTRG00000011758   Transcript: ENSTTRT00000011757
Sequence length 329
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2241:99466:116050:1 gene:ENSTTRG00000011758 transcript:ENSTTRT00000011757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRALHNQKKFGVAGRNCEEVLRKGCLHLQLPVPGSTLCLYEDGTEVTGDYFWSVPDDSEL
VLLTAGQTWQGYVSDISRFLSVFQEPHAELIQAARQLLSDERAPLRQKLLADLLGTVSEN
IAAETRAEDAPWFEGLESRFRNKSGYLRYSCESRIRSYLREXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPFDVDDCASRHSINPYSNRES
RVLFSTWNLDHVIEKKRTVVPTLAAAIHDAEGREVDWKYFYRLLFTSENLKLVHIACHKK
TTHKLLCDPSRIYRAPAVPRRKRRARQRP
Download sequence
Identical sequences ENSTTRP00000011152 ENSTTRP00000011152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]