SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011184 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011184
Domain Number 1 Region: 181-491
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.25e-59
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000777
Further Details:      
 
Domain Number 2 Region: 58-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000146
Family Seryl-tRNA synthetase (SerRS) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011184   Gene: ENSTTRG00000011792   Transcript: ENSTTRT00000011793
Sequence length 518
Comment pep:novel genescaffold:turTru1:GeneScaffold_2703:93797:105004:-1 gene:ENSTTRG00000011792 transcript:ENSTTRT00000011793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASIMRRLWPLVAARGLRLRGGCVCNQSPRRSFATERRDRNLLYEHAREGYSALPQLDM
EPLCAYPEEAARALELRKGELRSEDLPAIISTWQELRQQREQIRSLEEEKGAVAEAVQAL
LVNQDHNQVQQDPQYQSLRARGREIRKQLMLLYPKEAQLEEQFYLRALRLPNQTHPDVPV
GDESQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTLNKLIHRGFTPMTVPDLLRGAVFEGCGMTPNAKPSQIYNIDPSRFEDLNLAGTA
EVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTGKEPWGLYRVHHFTKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
SASNCTDFQSRRLHVMVQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPV
LQPYLSTDRITTPTHVPLQYIGPNQPQKPRLPGQPASS
Download sequence
Identical sequences ENSTTRP00000011184 ENSTTRP00000011184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]