SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011205 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011205
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000111
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011205   Gene: ENSTTRG00000011828   Transcript: ENSTTRT00000011815
Sequence length 300
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_511:38832:84248:1 gene:ENSTTRG00000011828 transcript:ENSTTRT00000011815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGRIAPKSTSLFAAASAGHGVFLLLVILSTLLGDGLASVCSLPPEPENGGYICHPRPC
RDPLNSGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCHLNEDKDAHTSLGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCVPPADPRVQIVLSEGSGPSGRSGPREQQLQDQGACSSAGGEEEAPGQPGLCE
ARGSRGSETVMVHQAAPSSWVAGSGNSRVAHKEAPDSENSDIQSLTSEDYTDDIPLLKEA
Download sequence
Identical sequences ENSTTRP00000011205 XP_019777613.1.83887 XP_019777618.1.83887 XP_019777624.1.83887 XP_019777625.1.83887 XP_019777632.1.83887 ENSTTRP00000011205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]