SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011260 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011260
Domain Number 1 Region: 773-972
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-47
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 1042-1233
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.06e-43
Family BAR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1534-1591
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 4 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 5 Region: 1300-1376
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000289
Family SH3-domain 0.00000869
Further Details:      
 
Domain Number 6 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000643
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 7 Region: 68-134
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000108
Family SH3-domain 0.0031
Further Details:      
 
Domain Number 8 Region: 241-306
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000158
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011260   Gene: ENSTTRG00000011864   Transcript: ENSTTRT00000011870
Sequence length 1597
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3361:226656:301975:-1 gene:ENSTTRG00000011864 transcript:ENSTTRT00000011870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEVVT
IPSLKEGERLFVCICEFTSLELNSLSLHRGDLVVLDGTPTAGWLQGRSCWGARGFFPSSC
VRELCLSSQSRQWHSQSALLQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNCDDCITNGEVDTNTGEETPEEEGE
QPGTYGIALYRFQALEPNELDFESDKIRILGTLKDGWLERSLKGQTGIFPYRFVKLCPQT
GVEETVDLPQESSLTNIPDTSLDCSEDFLEVERHESHEYXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXYYSIGGGSHPRPHPYSDPLPLEARTRDYSSLPPRRTYSQPKTLQKPVTPLHSTFSRL
ASRAVRPSQLSPQLQGMARCVKKHLTPKENASSFCSASEKSEMKPGLQDETPAVEAVALS
QGDGNTDLDSKLTQQLIEFEKSLSGPGTEPDKILRHFSIMDFNSEKDIFRGSSKLIIQQE
LPERRKALRPPPPRPCTPASTPPHLPVDQSLRPEPPLAMRPSRPAPLPPSAQQRTNAVPP
KLLTCNRPGWESLEKEGPENMEKTLDQTSQCPLVLVRIQEMEQDLDVCCRAQEELNLPLE
EKQEESLRADTPENLEFYESNIESLDMELQQLREMTLLSSQSSALVAPSGSVSTESPEQR
MLEKRAKVIEELLQTERDYIRDLEMCLERIMVPLQQAQIPNIDFEGLFGNMQMVIKVSKQ
LLADLEISDAVGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQDSLADL
KSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTSAVLAVKEI
NVNINEYKRRKDLGKKSILAEKESVHAQKRAFLTHFPVLKYRKGDEDSLMEKISKLNIHS
IIKKSNRVSSHLKHLTGFAPQKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACV
KVVAAVSMWDVCMEKGHRDLEQFEKVHRYISDQLFTNFKERTERLVISPLNQLLNMFTGP
HKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQG
LFSNCVHGYAEAHCDFVRQALEQLKPLLSLLKVTGREGNLIAVFHEEHSRVLQQLQVFTF
FPESLPATKRSFDRKTMDRQSTRKPLLGLPSYMLQSEELRASLLVRYPPEKLFQAERNFN
AAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNARRSHSDASV
GSHSSTESEHGSSSPRFPRRQNSGGTLTFNPSSVAVSFSSGPTQKQPPDTSSLTEFDQGT
LSASLNSESSPSRCPSDPDSPSQHGPWDSVDAARDLQQPAPTLRSSRNPRHPEMAGHSVP
GRNGQGRDLVKGCARTALSLDDRNGQLENSEAEGNQVYFAVYTFKARNPNELSVSANQRL
KILEFKDVTGNTEWWLAEVNGKKGYVPSNYICKTEYT
Download sequence
Identical sequences ENSTTRP00000011260 ENSTTRP00000011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]