SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011280 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000011280
Domain Number - Region: 12-119
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0671
Family Regulator of G-protein signaling, RGS 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011280   Gene: ENSTTRG00000011893   Transcript: ENSTTRT00000011891
Sequence length 142
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3361:549099:555263:-1 gene:ENSTTRG00000011893 transcript:ENSTTRT00000011891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAEGVPETHREEPVRDDAAVETAEEAREPAEADITELCRDMFSKMATYLTGELTATS
EDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQ
AAYKLDAYSKKLEAKYKKLEKR
Download sequence
Identical sequences ENSTTRP00000011280 ENSTTRP00000011280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]