SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011307 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011307
Domain Number 1 Region: 41-252
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-44
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 240-340
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000789
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011307   Gene: ENSTTRG00000011921   Transcript: ENSTTRT00000011921
Sequence length 343
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1476:20991:23899:-1 gene:ENSTTRG00000011921 transcript:ENSTTRT00000011921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSVLRAALQGPAPTAPPSEPLGFESPAGCGWNYRPSSPMESPGPSVRCPVQEQRARWERK
RACTARELLETERRYHEQLGLVATYFVGILRAKGTLRPPERQALFGPWELIYGASQELLP
YLEGGRWGQGLEGFCPHLELYTQFAANAERSRTTLQEQLKKNKRFRRFVRLQEGRPEFGG
IQLQDLLPLPLQRLQQYENLAIALAENTGPNSPDHEQLTRAARRISDTAQRVHTISQKQK
NDQHLQRVQALLSGRQAKGLISGRWFLRQGWLLVVPPRGEPRPRMFFLFSDALLMAKPRP
PLHLLQSGTFACQALYPMAECQLHRVFGHSGGPCGGLLSVKPP
Download sequence
Identical sequences ENSTTRP00000011307 ENSTTRP00000011307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]