SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011316 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011316
Domain Number 1 Region: 24-441
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-98
Family L-arabinose binding protein-like 0.0000000113
Further Details:      
 
Domain Number 2 Region: 846-1037
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-66
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 533-826
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.25e-54
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011316   Gene: ENSTTRG00000011930   Transcript: ENSTTRT00000011930
Sequence length 1047
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1476:139688:156499:1 gene:ENSTTRG00000011930 transcript:ENSTTRT00000011930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRSTGRPWQDNRTWEQAEALREAFQMVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDNHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDAAERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGEQKGPAGLL
Download sequence
Identical sequences ENSTTRP00000011316 ENSTTRP00000011316 XP_004271466.1.21590 XP_007108628.1.24612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]