SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011374 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011374
Domain Number 1 Region: 108-438
Classification Level Classification E-value
Superfamily Clc chloride channel 3.92e-68
Family Clc chloride channel 0.00044
Further Details:      
 
Domain Number 2 Region: 623-799
Classification Level Classification E-value
Superfamily CBS-domain pair 2.65e-19
Family CBS-domain pair 0.0024
Further Details:      
 
Domain Number 3 Region: 543-621
Classification Level Classification E-value
Superfamily Clc chloride channel 9.68e-19
Family Clc chloride channel 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011374   Gene: ENSTTRG00000011995   Transcript: ENSTTRT00000011995
Sequence length 814
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_599:152622:176768:-1 gene:ENSTTRG00000011995 transcript:ENSTTRT00000011995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVSKKVSWSGRDVDDDEAAPLLRRAARPGAPAGEATPLLNGAGPAAVRASPHSAFFRI
GQMSNVELDDELLDPDMDPLHPFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINH
TAFRTVEIKRWVICAMIGILTGLVACFIDIVVEKLAGLKYRVVKDNIDKFTARGGLSFSL
LLWASLNVAFVLLGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVIL
SVVGGLAVGKEGPMIHSGSVIAAGVSQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAG
VSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNVWDLSSPG
LINFGRFDTETMVYTIHEIPIFIAMGVVGGILGAVFNALNYWLTMFRIRYIHRPCLQVIE
AMLVAAVTATVAFVLIYSSRDCQPLQGSSVSYPLQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVWADPGKYALMGAAAQLGGIVRMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDV
FIEGLYDMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTCLRRREKVGIIVDVLSSTAS
NHNGFPVVEDADGTQPARLQGLILRSQLIVLLKHKVFIERSYMGLLRRRLRLKDFRDAYP
RFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQVPASALQEASLPRVFKLFRALGQHLV
VMDCIRVVGLVTRKDLARYRLGKGGLEELSLAQT
Download sequence
Identical sequences ENSTTRP00000011374 ENSTTRP00000011374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]