SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011462 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011462
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Globin-like 1.38e-40
Family Globins 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011462   Gene: ENSTTRG00000012087   Transcript: ENSTTRT00000012086
Sequence length 142
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2227:110575:111191:1 gene:ENSTTRG00000012087 transcript:ENSTTRT00000012086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLEAADRAAVRALWLKLGSNVGVYTTEALERTFLAFPSTKTYFLHLDLSPGSAQVRAHG
QKVADALTLAVDHLDDLPSALSALRELHAHKLRVDPVKFQLLVHCLLVTLARHYPGDFSP
SLQASLNKFLSHVISALAPNCH
Download sequence
Identical sequences ENSTTRP00000011462 XP_004322165.1.83887 ENSTTRP00000011462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]