SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011516 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011516
Domain Number 1 Region: 355-545
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-52
Family cAMP-binding domain 0.0000000121
Further Details:      
 
Domain Number 2 Region: 90-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.2e-36
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011516   Gene: ENSTTRG00000012154   Transcript: ENSTTRT00000012146
Sequence length 836
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2383:22386:392641:-1 gene:ENSTTRG00000012154 transcript:ENSTTRT00000012146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGCSGIGGKEQGNSVCFMVDGDGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGV
NKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITF
FTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDF
ISSIPVDYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFH
MTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYS
YALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQ
YQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNC
RKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKS
SKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV
AIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIGPISYPQMTA
LNSTSSTTTPTSRGRTQSPPVYTATSLSHGNLHSPSPSTQTPQPSAILSPCSYATAVCSP
PVQSPLATRTFHYASPTASQLSLTQQQAQQPPQTKQQPQTPQTPSSSAPKNEVHKSTQAL
HNTSLTREVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPPPVTTVHGSGLQAGIRGT
VPQRVTLFRQMSSGAIPPSRGVPPAPPPPAAAHQRESSSVLHTDPETEKPRFASNL
Download sequence
Identical sequences ENSTTRP00000011516 ENSTTRP00000011516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]