SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011672 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011672
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-31
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 3 Region: 285-389
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-28
Family Spectrin repeat 0.00000174
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-27
Family Spectrin repeat 0.00000303
Further Details:      
 
Domain Number 5 Region: 627-738
Classification Level Classification E-value
Superfamily Spectrin repeat 1.42e-19
Family Spectrin repeat 0.00000248
Further Details:      
 
Domain Number 6 Region: 737-839
Classification Level Classification E-value
Superfamily EF-hand 4.01e-19
Family Calmodulin-like 0.073
Further Details:      
 
Domain Number 7 Region: 842-912
Classification Level Classification E-value
Superfamily EF-hand 1.56e-18
Family EF-hand modules in multidomain proteins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011672   Gene: ENSTTRG00000012305   Transcript: ENSTTRT00000012305
Sequence length 913
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_251:27520:124717:-1 gene:ENSTTRG00000012305 transcript:ENSTTRT00000012305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALMEEHARQQHNERLRKQFAAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRYERSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLL
TTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYD
IGNDPQKKTGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRE
TADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYTGPDAVPGALDY
MSFSTALYGESDL
Download sequence
Identical sequences ENSTTRP00000011672 ENSTTRP00000011672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]