SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011677 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011677
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-27
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 335-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 47-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 256-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000104
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 175-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000015
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011677   Gene: ENSTTRG00000012311   Transcript: ENSTTRT00000012310
Sequence length 447
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_685:83841:88107:-1 gene:ENSTTRG00000012311 transcript:ENSTTRT00000012310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADRVSQEPQALLESALPSSKVPAFSDKDSLGDEMLAAALLKAKAQELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTEHDPEISEDTGSHGVLLGRFQKD
ISQGLKFEEAYEQEVSLKRQLGSSSGERLNRKIQDFGQVTVEEKRTPVGGRSEKYSDLGN
SFTVSSNLISQQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGVSKSSLRVTAELNIREST
Download sequence
Identical sequences ENSTTRP00000011677 ENSTTRP00000011677 XP_019786196.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]