SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011711 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011711
Domain Number 1 Region: 384-477
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.09e-36
Family Small-conductance potassium channel 0.00000501
Further Details:      
 
Domain Number 2 Region: 253-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011711
Domain Number - Region: 486-551
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0824
Family Outer membrane efflux proteins (OEP) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011711   Gene: ENSTTRG00000012344   Transcript: ENSTTRT00000012344
Sequence length 559
Comment pep:known_by_projection scaffold:turTru1:scaffold_96477:53485:73421:-1 gene:ENSTTRG00000012344 transcript:ENSTTRT00000012344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPRAAGSKPNPSTHIVMNSHRHNGFGGRPLGGGLGALGRDPPDPEAGHPPQPPNGPGIQ
VVVAKSEPAQPSPGSPRGQPQDQEEEEDEEEDEAGRQRGSGKPPSVGHRLGHRRALFEKR
KRLSDYALIFGMFGIVVMVTETELSWGVYSKESLYSFALKCLISLSTVILLGLVVLYHAR
EIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVPGHYRFTWTARLAFTYAPAAAE
ADVDVLLSVPMFLRLYLLGRVMLLHSRIFTDASSRSIGALNKITFNTRFVMKTLMTICPG
TVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCG
KGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETW
LIYKHTRLVKKPDHARVRKHQRKFLQAIHHGRLRSVKIEQGKLNDQTNTLADLAKTQNVM
YNLMSELHAQHEELEARLAALESRLDALGVSLQALPGLIAQAIRPPPPPLPPRPGSGPLD
PVARSPLHRRPPTAPSDCG
Download sequence
Identical sequences ENSTTRP00000011711 ENSTTRP00000011711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]