SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011719 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000011719
Domain Number - Region: 81-227
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00196
Family Brix domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011719   Gene: ENSTTRG00000012357   Transcript: ENSTTRT00000012352
Sequence length 306
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2067:16836:51805:1 gene:ENSTTRG00000012357 transcript:ENSTTRT00000012352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALDRVVKPKTKRAKRFLEKREPKLSENIKNAMLIKGGNASSTVTQVLRDVYALKKPYG
VLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIEVG
IEKFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNVRLAGL
EYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSM
KMPKALKPKKKKNVSHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERKAEDQEKKS
KRIKKD
Download sequence
Identical sequences ENSTTRP00000011719 ENSTTRP00000011719 XP_007112101.1.24612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]