SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011770 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000011770
Domain Number - Region: 124-147
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0532
Family Penicillin V acylase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011770   Gene: ENSTTRG00000012413   Transcript: ENSTTRT00000012407
Sequence length 355
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1542:45557:66226:-1 gene:ENSTTRG00000012413 transcript:ENSTTRT00000012407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAGPSARMALALLLLAGAGVSAAASSSAPPLFNVSLDAAPELRWLPVLQHFDRDFLRA
SMARIIGDTVPKWVLALIRKAVWELELFLPQPFTDEIRGQCDALNFTLADCILLNLAYES
TAFCTSIVAQDSKGNIYHGRNLDYSFGNFLRKLTVDVQFIKNGQVAFTGTTFIGYVGLWT
GQSPHKFTVSGDERDKGSWWENMIAALFQRHSPVSWLIRTTLSESENFEAAVYELAKTPL
MADVYYIVGGTFPQEGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPVPKRDDRRT
PAIKALNATGQANLSLETLFQVLSVFPVYNNYTIYTTVMSAASPDKYMTRIRNPS
Download sequence
Identical sequences ENSTTRP00000011770 ENSTTRP00000011770 XP_019788296.1.83887 XP_019788297.1.83887 XP_019788298.1.83887 XP_019788300.1.83887 XP_019788301.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]