SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011887 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011887
Domain Number 1 Region: 28-191
Classification Level Classification E-value
Superfamily SIS domain 0.0000523
Family mono-SIS domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011887
Domain Number - Region: 294-412
Classification Level Classification E-value
Superfamily SIS domain 0.000367
Family mono-SIS domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011887   Gene: ENSTTRG00000012528   Transcript: ENSTTRT00000012528
Sequence length 610
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1519:243720:266976:1 gene:ENSTTRG00000012528 transcript:ENSTTRT00000012528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKQFQLIETAEPDKCELSGYEAALPITEKSNPLTRDLDKADAEQIVRLLGKRDAEIF
QEEGQIRPTCQESTLTTMVAAGKVQEVPKEPEGGLVGLSGGTSGRMAFLMSVSFNQLMKG
LGQKPLYTYLVAGGDRSVMASREGMEDSALDGIEELKVAAGKKRVIVIGISAGLSAPSVA
AQMDYCMDNPAVFLPVLIDFNPVSMARNDPIEDWSSTFRQIAEQMQKLPEKRKAFVLNPA
TGPEGLSGSSQMKGGSATKILLETLLLAAHKTADRSIAASPRCLLEILRTFEWAHQVTSQ
SPKITTLMKQVSTSLEKKGVYLVGWQTLGIIAIMDGVECIHTFGADFQDVRGFLIGDHSD
MFNQKAELNQGPHFSSSHEDLTSILPSLAETDTVVFILTLDDNLKEVQMLVEVKEKTSHI
QALAHSTVGQPLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFGQPKSRCIESLLQAIHVPQPLSDDIRA
APISFHVQVAQEKEQVIPIALLSLLFRCSIEAQAYLAAAPSVREAVRSALTRPGRKRNAD
LLETLDPAVP
Download sequence
Identical sequences ENSTTRP00000011887 ENSTTRP00000011887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]