SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011930 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011930
Domain Number 1 Region: 95-364
Classification Level Classification E-value
Superfamily EndoU-like 1.57e-75
Family Eukaryotic EndoU ribonuclease 0.0000272
Further Details:      
 
Domain Number 2 Region: 47-86
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000314
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011930   Gene: ENSTTRG00000012573   Transcript: ENSTTRT00000012573
Sequence length 370
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_17:236414:251882:-1 gene:ENSTTRG00000012573 transcript:ENSTTRT00000012573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKACVPMIVAVLCGLAWAXXXXXXXXXXXXXXXXXXXXXXXLYSAPNSCRGRCLEAFDKH
HLCHCNARCPKFGNCCEDFESLCGREGFSHTSDVITKGETQSISEKIYRADTNKAQEEDI
VLNRQKCISPSEARDQVDRCPEPLFTYVNEKLFSKPTYAAFINLLDNYQRAVGRGEHFTA
QQLAEQDTFLSEVMKTAVMKELYGFLHQQNRYSTEQEFVNDLKNMWFGLYSRGKEDGDSG
GFEHVFLGEVKKGKVSGFHNWIHFYMQEKEGLVDYYSHICDGPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSPEFEFALYFLCFIARPGKVCQLSLGGHPLAIQTYTWDKSTYGNGKKHI
ATAYVVSPTQ
Download sequence
Identical sequences ENSTTRP00000011930 ENSTTRP00000011930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]