SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011950 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011950
Domain Number 1 Region: 82-261
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.95e-64
Family Brix domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011950   Gene: ENSTTRG00000012590   Transcript: ENSTTRT00000012592
Sequence length 291
Comment pep:known_by_projection scaffold:turTru1:scaffold_89806:48906:52706:-1 gene:ENSTTRG00000012590 transcript:ENSTTRT00000012592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRREARLRREYLYRKACEEARRTAQERKDKVRRALEENRLIPTELRREALALQGSLEFD
DAGGEGVTSHMDDEYRWAGVEDPKIMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHE
VGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTAS
EAKPHLIMHGFSSRLGKRVSDILRYLFPVPKDDSRRVITFANQDDYISFRHHVYKKTDHR
NVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSAE
Download sequence
Identical sequences XP_004276942.1.21590 XP_004331060.1.83887 XP_012391053.1.21590 XP_019787339.1.83887 ENSTTRP00000011950 ENSTTRP00000011950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]