SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011953 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011953
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-33
Family cAMP-binding domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-32
Family cAMP-binding domain 0.000000522
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011953   Gene: ENSTTRG00000012596   Transcript: ENSTTRT00000012597
Sequence length 380
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_746:174476:187733:1 gene:ENSTTRG00000012596 transcript:ENSTTRT00000012597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSTASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEE
AKQIQTLQKASARADSREDEISPPPPNPAVKGRRRRGAISAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGE
MDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAA
VLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVAARGPLKCVKLDRPRFERVLGP
CSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences ENSTTRP00000011953 XP_004275464.1.21590 XP_004319072.1.83887 XP_004319073.1.83887 ENSTTRP00000011953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]