SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011979 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011979
Domain Number 1 Region: 433-577
Classification Level Classification E-value
Superfamily CBS-domain pair 4.64e-16
Family CBS-domain pair 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011979
Domain Number - Region: 671-720
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000732
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011979   Gene: ENSTTRG00000012626   Transcript: ENSTTRT00000012625
Sequence length 876
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2680:229301:335899:1 gene:ENSTTRG00000012626 transcript:ENSTTRT00000012625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGWGTCEPEVKMAGGQAAAALPTWKMAARRSLSSRGRGVLQAAAGRLLPLLLLSCCCGA
GGCAAAGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAF
TEHERRRHSPGERGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPL
RKMEKSKSYYLCTSLSTPALGAGGPGSAGGAVGGKGGSGVAGLPPPPWAETTWIYHDGED
TKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKN
YAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTIGIVIFGEIVP
QAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTR
IPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKK
GKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHR
ERKQDFSAFKQTDSEMKVKISPQLLLAMHLVFISIEVEAFSPSQMSEKILLRLLKHPNVI
QELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALT
ASPVPLSLSRTFVVSRTELXXXXXXXENKSPPRPCGLNHSDSLSRSDRIDAITPTLGSSN
NQLSSSFLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTL
TELHDGLPDETANLLNEQNCVTHSKANHSLHSEGAI
Download sequence
Identical sequences ENSTTRP00000011979 ENSTTRP00000011979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]