SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012000 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012000
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012000   Gene: ENSTTRG00000012646   Transcript: ENSTTRT00000012647
Sequence length 532
Comment pep:known_by_projection scaffold:turTru1:scaffold_98585:12294:32473:-1 gene:ENSTTRG00000012646 transcript:ENSTTRT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKVAIIGAGISGLASIRSCLEEGLEPTCFEKGEDVGGLWKFSDHAEEGRASIYRSVFT
NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITAFAKEKNLLRYIQLKTLVSSVNKRPDFS
VTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNLPKESFQGLQLFKGKCFHSWDYKEPG
IFKGKRVLVIGLGNSGCDIASELSHTAEQVIVSSRSGSWVMSRVWHGGYPWDMMFITRFE
TFLNNNLPTVISDWWYVKQMNARFKHENYGLMPLNGTLRKEPVFNDELPARILCGTVTVK
PNVKEFTETSAIFEDGTVFEAIDCVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPS
LEKPTMAVIGLVQSLGAVIPTTDLQSRWAVRVIKGTCTLPSVKDMMNDIDEKMGKKLKWF
GKSNTIQTDYIVYMDELASLIGAKPNIPWLFLTDPKLALEVYFGPCSSYQFRLVGPGKWP
GARNAILTQWDRTLKPTTTRIVGSPLKPCLFCSWFRPVLISVLSIAAFLVLF
Download sequence
Identical sequences ENSTTRP00000012000 ENSTTRP00000012000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]