SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012023 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012023
Domain Number 1 Region: 1233-1392
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-69
Family Pleckstrin-homology domain (PH domain) 0.0000000647
Further Details:      
 
Domain Number 2 Region: 1030-1107,1143-1237
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.42e-39
Family DBL homology domain (DH-domain) 0.00000009
Further Details:      
 
Domain Number 3 Region: 453-575
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 838-907
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000359
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012023   Gene: ENSTTRG00000012651   Transcript: ENSTTRT00000012671
Sequence length 1582
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2097:10623:137612:-1 gene:ENSTTRG00000012651 transcript:ENSTTRT00000012671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVVHEFYGEKHASLGRKHTSRSLRLSHKVRRTRHASSGKVIHRTSEVTTRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVSPSVGSSIVLAA
ASVQSMPDSEESRLYGDDATYLAEGGRRQHPYTSDGPTFTETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEETRGMEAPASPRQLSTCQRANSLGDLYAPQK
TSGVTADGGRRGKFAGYCRNLVSDIPDLGNHKMPPAAAEEALPYSNYNTLPCRKSHCLSE
GATNPQMSHNNSMQGRRAKTTQDVNAGEGSEFADSGIEGIDTDLSRRSNANSSYSPPTGR
AVGSDSGSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTSSPGQSDIL
LTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGID
HNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSAC
AAAVARHHHKEDTLQLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQIFV
WEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALV
AARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGTEAVKKS
LEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNKPVLTAVRPGDT
ARDTLELICKAHRLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICPKVTQNI
QIEKSDTAGDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINNRAAGTL
NASVLKDFLAQLSLGLLVRTYPELEGEAELLGSPPLRLDGPADLSENPLAFLTSNTGHSL
CSQQGSSESAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNSSDPSPSPQDSAGP
QLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGN
LTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKMDAAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLLKELFALT
DAESEEHYHLDLAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDL
LLHTTVIWPNPPASLGKWKKEPELAAFVKTAVLVYKDGSKQKRKLVGSHRLSIYEDWDPF
RFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKEFLKA
VHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMNRAVSAPSKSLGRRRRR
LARNRFTIDSDAISASSPEKESQQHPGGGDTDRWVEEQFDLTQYEEHDDVKETDILSDDD
EFCESVKGAAADRDLQERLQAASISQRERCQKALDSHASRMTQLKKQAALSGVNGGPEST
SDEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences ENSTTRP00000012023 ENSTTRP00000012023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]