SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012105 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012105
Domain Number 1 Region: 20-153
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-45
Family Regulator of G-protein signaling, RGS 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012105   Gene: ENSTTRG00000012763   Transcript: ENSTTRT00000012758
Sequence length 159
Comment pep:known_by_projection scaffold:turTru1:scaffold_83965:82676:99042:-1 gene:ENSTTRG00000012763 transcript:ENSTTRT00000012758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRNCWICKMCRDDSKRPPSNLTLEEALQWAQSFEKLMATKYGPVVYAAYLKMEHSDEN
IKFWMACETYKKVASQRSRTSRAKKLYRTYIQPQSPREINIDSSTRETIIKNIQEPTQTC
FEEAQKIVHMHMERDSYPRFLKSEMYQKLLKTIQPNNNS
Download sequence
Identical sequences ENSTTRP00000012105 ENSTTRP00000012105 XP_004275891.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]