SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012112 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012112
Domain Number 1 Region: 382-505
Classification Level Classification E-value
Superfamily EF-hand 9.98e-48
Family EF-hand modules in multidomain proteins 0.0000092
Further Details:      
 
Domain Number 2 Region: 508-602
Classification Level Classification E-value
Superfamily EF-hand 1.36e-34
Family EF-hand modules in multidomain proteins 0.0000399
Further Details:      
 
Domain Number 3 Region: 584-670
Classification Level Classification E-value
Superfamily RING/U-box 8e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000317
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000113
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000095
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012112   Gene: ENSTTRG00000012757   Transcript: ENSTTRT00000012766
Sequence length 937
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_574:10855:38927:1 gene:ENSTTRG00000012757 transcript:ENSTTRT00000012766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTLPRCHEWRAADHFHHSSSLRSTCPQPQVRAAASTPAPPHDGAGVPYLS
PKLFNGSVGAAGPLEPPAMNLCWNEIKKKSHSLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSATLTQAEGVRATWEPIGDLFIDSLPEHIQALKLFKEEFFPMKDGVKLVNDLAHQLA
ISDVHLSMENSRALEQINIRWKQLQVSVGERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEVAQFLEWVNLEPQSMVWLAVLHRVTI
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMLPHADTHSR
IEHFASDESDEDQYLLRHSSPITDREPAFGQQAPCSMATESKGELEKILAHLEDEKRILQ
GELRRLKWQHEEAAEAPTLAEGSAEVAQDHRNEELLAEARILRQHKSRLETRMQILEDHN
KQLESQLQRLRELLLQPHTESDGNGSAGSSLASSPQQSEGSHPQEKGQTTPDTQAADDVG
SKSQDVSLCLEDIMEKLRHAFPSVRSSDVTTNTLLAS
Download sequence
Identical sequences ENSTTRP00000012112 ENSTTRP00000012112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]