SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012154 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012154
Domain Number 1 Region: 133-188
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000209
Family SOUL heme-binding protein 0.00017
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000011
Family SOUL heme-binding protein 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012154   Gene: ENSTTRG00000012817   Transcript: ENSTTRT00000012810
Sequence length 189
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_61:96976:122488:-1 gene:ENSTTRG00000012817 transcript:ENSTTRT00000012810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMIKNSLFGSVETWPWQILSKGGKGEVSYEERACEGGKFATVEVTDKPVDEALREAMP
KVVKYVGGSNDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXQFGGYAKATDYVAHAAELRTTLEGTATCRSDFYFCTGYDPPMKPYGR
RNEVWLVKK
Download sequence
Identical sequences ENSTTRP00000012154 ENSTTRP00000012154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]