SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012171 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012171
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000774
Family SH3-domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012171
Domain Number - Region: 586-652,752-940
Classification Level Classification E-value
Superfamily ARM repeat 0.00157
Family MIF4G domain-like 0.043
Further Details:      
 
Domain Number - Region: 437-520
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0139
Family PLC-like (P variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012171   Gene: ENSTTRG00000012829   Transcript: ENSTTRT00000012829
Sequence length 1959
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1190:65876:323620:-1 gene:ENSTTRG00000012829 transcript:ENSTTRT00000012829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNK
GQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVG
HLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKD
TPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDK
PERQCSLFVDLGSSELRRDIYITVHIIRIGRMGAGEKKNACSVQYRRPFGCAVLSIADLL
TGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVSLQLLHGDIEQIR
REYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSVARNVEVTMFIVE
SSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGAHIRFEFRHC
STKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLPFSKGIL
LGNNNQAMKATKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEIDGSEI
VKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPVMDTYIESHFAGA
LAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFSLATGGQNEEEFR
RCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFDVREVANLVQDTLG
SLPTIVHVDDALQAVKLQCISKTVESQLYTNPDSRYILLPVVLHHLHMHLQEQKDLIMCA
RILSNVFCLIKKNSSEKSVLEEIDLIVASLLDILLRTILEITSRPQPSGSTMRLQFQDVT
GEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIRPEMFPKDWTVMR
LVANXXXXXXXXXXXXXXXXXXXXXXXXXXIWDSYFYLAVIFINQLCLQLEMFTPSKKKK
VLEKYGDMRVTMGCEIFSMWQNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFHDM
MDWEQRRSGNFIQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYIRYH
KLYDLHVKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLAIIQNFD
RGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGK
KFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYLQIYA
VTPIPDSQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLY
LVQSLPGISRWFEVEKREVVEMSPLENATEVLENKNQQLKTLISQCQTRQMQNINPLTMC
LNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKIARLRELMLEQAQILEFGLAVHEKF
VPQDMRPLHKKLVDQFFVMKSSLGIQEFSACIQASPVHFPNGSPRVCRNSAPASMSPDGT
RVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLSSTHS
ASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRLLFNHIGD
GALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDGGKLISPPVPPRPTQTASPARHT
TSVSPSPAGRSPLKGSMQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSG
FENQVNEQSVAPGSGSGHSGSEELVRKESKTPPPYSVYERTLRRPVPLPHSLSIPITAEP
PALPPKPLAARSGHLENGTRRTDPGPRPRPLPRKVSQLE
Download sequence
Identical sequences ENSTTRP00000012171 ENSTTRP00000012171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]