SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012232 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012232
Domain Number 1 Region: 603-816
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-51
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 412-509
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-29
Family Pleckstrin-homology domain (PH domain) 0.00000257
Further Details:      
 
Domain Number 3 Region: 116-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.18e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00095
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.15e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012232   Gene: ENSTTRG00000012890   Transcript: ENSTTRT00000012895
Sequence length 837
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_651:14295:46007:-1 gene:ENSTTRG00000012890 transcript:ENSTTRT00000012895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPSHPAGLPGSPGPGSPPPSGSLELQAPPPLLSHVPAPGSGVSFHIQIGLTREFVLL
PTASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCEGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLLSMTDELSRSTTELIPRRPTSSSSS
SSVSSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSSLMDESDDSGFVPGSHSENALH
ASEEEEGEGGKAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIVTANTTYFVGE
TPGGAPGGPSGQGAETARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIP
ENVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
XXXXXXXXXXXXCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDIKDQIQNAAFMYPACPWSCISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARW
Download sequence
Identical sequences ENSTTRP00000012232 ENSTTRP00000012232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]