SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012238 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012238
Domain Number 1 Region: 45-120
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-24
Family L-arabinose binding protein-like 0.00018
Further Details:      
 
Domain Number 2 Region: 170-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.65e-18
Family L-arabinose binding protein-like 0.00038
Further Details:      
 
Domain Number 3 Region: 474-517
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000565
Family L-arabinose binding protein-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012238   Gene: ENSTTRG00000012883   Transcript: ENSTTRT00000012901
Sequence length 889
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2922:26836:59224:-1 gene:ENSTTRG00000012883 transcript:ENSTTRT00000012901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDLPSWPLFVAVPACPQLPNVPVLGPHCPPCLGSLTSIHSPGVLPLQIPQISYASTAPEL
SDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVDAFVQISREAG
ELGALRHEGPYRVCWTGHKQGRAGFMMGSLDGAPCGGPLEDSALPQAVVVALSIKIPREP
KPGEFNKVIRRLMETPNARGIIIFANEDDISPILTRRVLEAARQANLTSYFLWVGSDSWG
AKISPILNLEDVAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEEFNCKLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGLCPAMEPDGRTLLQYIRCTFQWLNNIPLYVTQFAYPFIRWTLAFLPHFSYVNAAV
NISVQISLESLLSIILGILEKELLDCVVILFNFLRNHHIIFHTDCIIFPPVKYGSAGTPV
MFNENGDAPGRYDIFQYQVTNGSAGSGSYQAVGQWAETLRLDVSARDELWAEADPPSWGW
ESQVPVSPVSQVEALQWSGDPREVPESQCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQ
VDEFTCEACPGDMRPTHNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIMATTTVVATFVR
HNNTPIVRASGRELSYVLLTGIFLIYTVTFLMVAEPGAAVCAARRLFLGLGTTLSYSALL
TKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFSFTSVQYFSVKHLSASVSLGMLYEVES
EPWNYLGEGVWMLRTAHNPGVSQTVVHLVMVYSKTRKARLHMLVKPAAGAATGMVAEGLG
LSPNASTFQGAAALMRVLQMGKATNKVSEICSLGIQGLLTSVNSLVMDE
Download sequence
Identical sequences ENSTTRP00000012238 ENSTTRP00000012238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]