SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012282 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012282
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.06e-64
Family Proteasome subunits 0.00000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012282   Gene: ENSTTRG00000012948   Transcript: ENSTTRT00000012948
Sequence length 277
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1017:85222:152653:-1 gene:ENSTTRG00000012948 transcript:ENSTTRT00000012948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSVYEPPVGGFSFENCRRNAILEADFAKKGSKLPMARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEDAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTTLEIEVLEETVQTMDTS
Download sequence
Identical sequences XP_004269286.1.21590 XP_004329083.1.83887 ENSTTRP00000012282 ENSTTRP00000012282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]