SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012295 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012295
Domain Number 1 Region: 225-540
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000667
Further Details:      
 
Domain Number 2 Region: 93-212
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.49e-24
Family Anticodon-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012295   Gene: ENSTTRG00000012961   Transcript: ENSTTRT00000012961
Sequence length 546
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2898:285787:299275:-1 gene:ENSTTRG00000012961 transcript:ENSTTRT00000012961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXALMTVGKEPFPTIYVDSQKENERWDVISK
SQMKNIRKLWHREQMKSESREKKEAEDTLRREKNLEEAKKITIKNDPSLPEPSCVKIREL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA
VYGMLNLTPKGKQAPGGHELNCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILKARSVVTRCFRDHFFDRGYCEISPPTLVQTQVEGGATLFKLDYFGEEAYLTQSS
QLYLETCIPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFEELLNRLEDLVCD
VVDRVLKSPVASVVRDLNPNFKPPKRPFKRMNYSDAIVWLKEHNIKKEDGTFYEFGEDIP
EAPERLMTDTINEPILCRFPVEIKFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIWDN
EEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILDRYHIRDVCLYPRF
VQRCKP
Download sequence
Identical sequences ENSTTRP00000012295 ENSTTRP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]