SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012328 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012328
Domain Number 1 Region: 32-280
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.71e-27
Family DNA/RNA non-specific endonuclease 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012328   Gene: ENSTTRG00000012998   Transcript: ENSTTRT00000012994
Sequence length 431
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1894:34556:62331:1 gene:ENSTTRG00000012998 transcript:ENSTTRT00000012994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPARCLALGGLLALAGLLEGRLVSEQAGFGECDRFFYAGTPPAGLAAAAHVKICQRSEG
AERFANLYSTWDRIPVYSAFRAARXXXXXXXXXXXXXXXIDDPNSSLEEVMDEADAISSV
NNLGSKQALHADYLGSEYQTGQLYPFSLSSDPDTATFTLTNAAPMTPSFQKRWYVNLNSL
MDRALSPQCGDGEELYIIAGAVPSDLKVNDKVTIPEFVWLAACCAVPGGGWAMGFVKHTG
DREVIEDVMVKELEKLLPFTPQLFQNNCGESEQDTEKMKKILEMVNQVQDEERRVDSEGD
AGTLSSTRSTRSTLLPPEASGERSSLLRKLLGFAATPFIKLCQLIYFLAVRILKYLVYFL
WYVTKQVTCGLESCLYRLGSATVSYFLTIGEELASIPWVLKVMVRITRAILRILCCLLVV
CRIVGIPVRVL
Download sequence
Identical sequences ENSTTRP00000012328 ENSTTRP00000012328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]